DPCfam | MC297009
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 252 ± 63 aa |
| Residues in low-complexity regions (%) | 5.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.47 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF10433 |
| Sequences matching dominant architecture (%) | 82.28 |
| Average overlap percent | 13.52 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F6V136 | 535-843 | 309 | EKTELPTKTQQQQHSYLILSREESTLILETGKEIMEVENSGFNTREQSVFVGNIGGDKELILQVCASGVWLLAGVKLLQHIPLEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IC37-F1 | 585-875 | 99.65 | 71.83 | View in AlphaFoldDB ↗ |