DPCfam | MC29679
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 292 ± 15 aa |
| Residues in low-complexity regions (%) | 6.84 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.81 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF09139 |
| Sequences matching dominant architecture (%) | 16.33 |
| Average overlap percent | 42.64 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A084IP63 | 44-316 | 273 | IVYYGSCLRSGDPTAGLVDFYVIVDRYQAAHASTVAAAANRLLPPNVYYLECATDTVTLRCKYAVITLDDLQRGVAHGRLSSLWG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q61X59-F1 | 15-214 | 61.62 | 94.31 | View in AlphaFoldDB ↗ |