DPCfam | MC296770
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 481 |
|---|---|
| Mean domain length (aa) | 146 ± 31 aa |
| Residues in low-complexity regions (%) | 1.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.09 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05787 |
| Sequences matching dominant architecture (%) | 90.72 |
| Average overlap percent | 41.25 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C1EHZ5 | 145-371 | 227 | TASPNTVWAVVHLEDRPANIQVLELEQAAATGILTVKKIHKADFSADGGLIATCAGSVSPWNTHLGGEEWGVPSSLKWDSAVTGA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I0K3-F1 | 257-434 | 98.62 | 96.26 | View in AlphaFoldDB ↗ |