DPCfam | MC29677
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Residues in low-complexity regions (%) | 4.06 |
| Residues in coiled-coil regions (%) | 6.85 |
| Predicted disordered residues (%) | 25.04 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q9DX05 | 712-809 | 98 | MKLQVHGGCPQMCELEALSLIARLEDRKLENLANETITTSDKLAVAAMAMEHHWNHYLYDYVATGAFESGLRAVRDAPFFEDLPG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1K5E1-F1 | 252-280 | 29.29 | 93.81 | View in AlphaFoldDB ↗ |