DPCfam | MC296762
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 219 ± 46 aa |
| Residues in low-complexity regions (%) | 10.88 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 55.79 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00397 |
| Sequences matching dominant architecture (%) | 45.36 |
| Average overlap percent | 13.12 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A078J4D0 | 227-408 | 182 | WIETLDETSGHKYYYNTKTHVSQWEPPASLKKPSATNTNGKREIPPSQMPRCSGCGGWGVGLVQSWGYCAHCTRVFNLPEQQYLA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7K8S1-F1 | 288-491 | 79.58 | 62.08 | View in AlphaFoldDB ↗ |