DPCfam | MC296530
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 78 ± 11 aa |
| Residues in low-complexity regions (%) | 0.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00300 |
| Sequences matching dominant architecture (%) | 85.54 |
| Average overlap percent | 20.79 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000359B822 | 204-276 | 73 | GDILIVAHAGSLDTFTRRLLGKSPRNSQEMHQILSSFTYCSFCCCVENSKTGKWALGQPPIPPLHEFNWKVLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0B4J1A8-F1 | 560-637 | 97.47 | 90.42 | View in AlphaFoldDB ↗ |