DPCfam | MC29650
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 60 ± 6 aa |
| Residues in low-complexity regions (%) | 0.13 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.87 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07792 |
| Sequences matching dominant architecture (%) | 98.17 |
| Average overlap percent | 68.48 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M5FWT2 | 13-72 | 60 | SGEHVSYILVAEFDIDTGSQLTHQFPYPTGADKQLLAEVMLPEGVHNRSEDWTVFLLNQN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W2F7-F1 | 113-169 | 96.67 | 87.98 | View in AlphaFoldDB ↗ |