DPCfam | MC2964
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 137 ± 18 aa |
| Residues in low-complexity regions (%) | 1.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.78 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16592 |
| Sequences matching dominant architecture (%) | 98.51 |
| Average overlap percent | 29.48 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R5GJ26 | 315-440 | 126 | ISEAKVKTYEKHSEDLAALRRVVRKYHPDKYKEIFKKYVVGNYTSYSGNVKSAGKISETKLKRCNQAEFCDYLKSKLKDVKPAPG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q927P4-F1 | 300-437 | 100.00 | 86.19 | View in AlphaFoldDB ↗ |