DPCfam | MC296289
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 113 ± 20 aa |
| Residues in low-complexity regions (%) | 4.88 |
| Residues in coiled-coil regions (%) | 27.86 |
| Predicted disordered residues (%) | 43.15 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF08549 |
| Sequences matching dominant architecture (%) | 36.15 |
| Average overlap percent | 36.25 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X2GVN7 | 40-182 | 143 | ASQKRHKPSHHTPPAHEDRDEPSGDELDDISARDIAMARYKRNHDYLSEIFTPYNADHIVPPPFDITQTKDELQKLMDDQHQAIK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W9H5-F1 | 270-417 | 94.87 | 78.92 | View in AlphaFoldDB ↗ |