DPCfam | MC296100
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 471 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Residues in low-complexity regions (%) | 1.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D1C9X9 | 15-133 | 119 | YLPLADYGVIGDGRSIALVANTGAIDWWCLPRFDGDPIFARLLDTRLGGSCVIQPRCSFHGRQAYLGETNVLATTFTTDAGEARV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W940-F1 | 24-158 | 99.13 | 87.45 | View in AlphaFoldDB ↗ |