DPCfam | MC295939
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 322 ± 59 aa |
| Residues in low-complexity regions (%) | 6.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.54 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF00627 |
| Sequences matching dominant architecture (%) | 55.56 |
| Average overlap percent | 10.43 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A131XN44 | 39-412 | 374 | LKQMSLSHFCNPLDCIKLSDYYKLVSVSQARPLCDQSSVREEKIRDGDELLLLKRSSASSLSTNKATEVTEGQKQAVPDKAAIDL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9BSL1-F1 | 47-401 | 99.71 | 73.91 | View in AlphaFoldDB ↗ |