DPCfam | MC295724
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 239 ± 25 aa |
| Residues in low-complexity regions (%) | 2.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 38.8 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14896 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 72.05 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E2MWZ7 | 864-1098 | 235 | GLNPDKVPVLGSYSEDIQRPANLETSWFQLPEIDEDHPLLVVSAAGRIFHHDINGVAQPGRKLVAQYGRKGGDEDGFEVLSESEP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ELF6-F1 | 831-1072 | 99.15 | 92.93 | View in AlphaFoldDB ↗ |