DPCfam | MC295414
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 241 ± 14 aa |
| Residues in low-complexity regions (%) | 3.4 |
| Residues in coiled-coil regions (%) | 3.22 |
| Predicted disordered residues (%) | 18.08 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07072 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 85.88 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q1LIP2 | 1-247 | 247 | MILYEYPFNERIRTLLRLEDLFDRLDYFLGQEHPLQHHVAITTIFEIIDVAGRADLKTDLIKELERQRQALAPLRSNPQIDQDAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P60012-F1 | 2-248 | 100.00 | 94.02 | View in AlphaFoldDB ↗ |