DPCfam | MC295105
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 184 ± 18 aa |
| Residues in low-complexity regions (%) | 7.1 |
| Residues in coiled-coil regions (%) | 0.21 |
| Predicted disordered residues (%) | 1.36 |
| Average transmembrane regions | 4.94 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006850371 | 8-231 | 224 | FYVGMALFLIAVILIGFVPDSFLRAGDIAAGGRPGFLWQAHFHALTMAAWMGLLLTQTVLMATGRNRWHMQLGLFGMVLAPLMVI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FZG3-F1 | 63-134 | 37.84 | 95.80 | View in AlphaFoldDB ↗ |