DPCfam | MC295099
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 601 |
|---|---|
| Mean domain length (aa) | 145 ± 14 aa |
| Residues in low-complexity regions (%) | 16.35 |
| Residues in coiled-coil regions (%) | 0.11 |
| Predicted disordered residues (%) | 2.57 |
| Average transmembrane regions | 3.97 |
| Dominant Pfam architecture(s) | PF09925 |
| Sequences matching dominant architecture (%) | 99.57 |
| Average overlap percent | 87.41 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000494E0C5 | 8-147 | 140 | KRVASDLEAWVEKGWVSADNASNILASLDKEDAPSKLPVVITVLGAVLIGFSAMAFVAANWAEMSKGLRLGMLAVAMWSAYGTAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I5J3-F1 | 35-188 | 89.40 | 85.49 | View in AlphaFoldDB ↗ |