DPCfam | MC295040
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 245 ± 38 aa |
| Residues in low-complexity regions (%) | 4.28 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.77 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF17781 |
| Sequences matching dominant architecture (%) | 90.53 |
| Average overlap percent | 83.73 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3D9X5 | 61-303 | 243 | KFLRPHYGKLKEIYDGMAPGENKRFCADVVSVLAMTMSGERECLKYRLLGSQEELASWGHEYVRHLAGEVAKEWQEVEENDKTQQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0G2KH95-F1 | 87-327 | 99.18 | 83.13 | View in AlphaFoldDB ↗ |