DPCfam | MC294834
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 98 ± 13 aa |
| Residues in low-complexity regions (%) | 1.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01266 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 27.61 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P7BLU5 | 183-270 | 88 | SRIAGVETAAGTRLFCDVVVLATGAWTSSLVPDDVGLDMLAVGQPVGFIQLSPGEAKRLSAMPVMLKLARHGFGYATRVDVGDGR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NV63-F1 | 225-315 | 98.94 | 88.85 | View in AlphaFoldDB ↗ |