DPCfam | MC294566
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Residues in low-complexity regions (%) | 0.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04616 |
| Sequences matching dominant architecture (%) | 31.58 |
| Average overlap percent | 5.92 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007817C64 | 1978-2051 | 74 | AVEGPSIFTSNPGDVSGDYYYLFVDEYGGRGYIPLRTEDIADPDWQVAPEYDLPASPRHGTVIPVTAAELEALR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VRM5-F1 | 225-285 | 79.22 | 94.86 | View in AlphaFoldDB ↗ |