DPCfam | MC294524
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 95 ± 12 aa |
| Residues in low-complexity regions (%) | 4.37 |
| Residues in coiled-coil regions (%) | 1.44 |
| Predicted disordered residues (%) | 26.22 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF14308 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 41.0 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E4SU92 | 171-269 | 99 | KKESKSKIEYERIKKQQAEEVKKVEELSVKLIKKLQPLIDTATSTGSIQNEPLIEFTNSILKEIESLKAESFGLDICHVIGKVYY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2DRH2-F1 | 240-327 | 95.65 | 93.02 | View in AlphaFoldDB ↗ |