DPCfam | MC294387
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 108 ± 6 aa |
| Residues in low-complexity regions (%) | 13.85 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.15 |
| Average transmembrane regions | 3.45 |
| Dominant Pfam architecture(s) | PF13886 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 43.71 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C3HSC5 | 60-164 | 105 | TLPITPAITPGFSAAGVLLILSGAVYAILGIRYKYLHVFISAAYLTSLAVAVLIIYVMSLPVRNSIQGAYVAASIVAGLIVGGAS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q2T1-F1 | 12-117 | 100.00 | 89.73 | View in AlphaFoldDB ↗ |