DPCfam | MC294338
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Residues in low-complexity regions (%) | 1.99 |
| Residues in coiled-coil regions (%) | 48.31 |
| Predicted disordered residues (%) | 22.47 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14775 |
| Sequences matching dominant architecture (%) | 99.15 |
| Average overlap percent | 82.61 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005238D8E | 632-696 | 65 | DEEYWEALAHILPESTLKLWDALTLALEEYYEVLMHRANLLAEVATLRQQNVELCLLLKEYLTSG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3USS3-F1 | 667-737 | 100.00 | 89.71 | View in AlphaFoldDB ↗ |