DPCfam | MC29426
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 115 ± 13 aa |
| Residues in low-complexity regions (%) | 6.13 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01429 |
| Sequences matching dominant architecture (%) | 44.12 |
| Average overlap percent | 39.43 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A164VS24 | 194-291 | 98 | LGDSDEYYSEELKKRTEGLRTEEDGLGFLRGLNGKWCSRRKKRKFVDASEFGDKFPVGWKIILGLRRRNGCVSLYCRRYVSPVGE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0FWR2-F1 | 148-262 | 98.29 | 90.78 | View in AlphaFoldDB ↗ |