DPCfam | MC294117
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 103 ± 13 aa |
| Residues in low-complexity regions (%) | 3.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.84 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17172 |
| Sequences matching dominant architecture (%) | 65.31 |
| Average overlap percent | 25.13 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0E9NNF6 | 15-104 | 90 | VPKPMAQLFDKFPLVEHPAALLPATPNTPKHADQPTLYIYSTAIDSSAHSPSFDAECLKWQTALLLAGLPFNAVSSNRHASPTFT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GPS0-F1 | 24-116 | 95.88 | 89.25 | View in AlphaFoldDB ↗ |