DPCfam | MC294059
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 67 ± 7 aa |
| Residues in low-complexity regions (%) | 1.0 |
| Residues in coiled-coil regions (%) | 0.29 |
| Predicted disordered residues (%) | 19.74 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02901 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 18.56 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J5I7J7 | 82-144 | 63 | SLGFVNVADSLAAIQKLVFEEKKYTMDELLCAMKSNWDGYEEMRQDFLNAPKYGNDDDYVDEW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E5Y378-F1 | 592-654 | 98.44 | 98.60 | View in AlphaFoldDB ↗ |