DPCfam | MC293611
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 244 ± 46 aa |
| Residues in low-complexity regions (%) | 5.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.46 |
| Average transmembrane regions | 0.46 |
| Dominant Pfam architecture(s) | PF12070 |
| Sequences matching dominant architecture (%) | 88.51 |
| Average overlap percent | 51.04 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q5Z480 | 336-598 | 263 | LPSNGMMLIYLSAAGEVGSSGFCPDTNEMVVSSLNKFDISNTSTINVNEDNGPRLWLGCREGEGSNCIYPCDLIPFTRRPLFLVI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8N9R8-F1 | 349-598 | 99.60 | 91.55 | View in AlphaFoldDB ↗ |