DPCfam | MC293256
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 351 |
|---|---|
| Mean domain length (aa) | 351 ± 42 aa |
| Residues in low-complexity regions (%) | 3.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.25 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00092 |
| Sequences matching dominant architecture (%) | 0.39 |
| Average overlap percent | 46.55 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I0HXM9 | 288-604 | 317 | TTAEYNAAIQNFANWFQYYRKRKLMLSAASGQVLESLTGLRMGVVNFNNQASVTMYDIDSTSASTNGRRLAGIFYANPSSGGTPT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-S0HPF7-F1 | 190-554 | 99.69 | 84.57 | View in AlphaFoldDB ↗ |