DPCfam | MC29325
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 94 ± 11 aa |
| Residues in low-complexity regions (%) | 1.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03564 |
| Sequences matching dominant architecture (%) | 20.69 |
| Average overlap percent | 58.23 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006C9549D | 235-331 | 97 | VPESSEMQQFAKYLIRKELVSTGLLQFDDKPENYWAWKTSFISATKDLNLSPREELDLLTKWLGPTSSEQAKRIRAVHTLNPAAG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0N4U1B5-F1 | 68-143 | 83.51 | 88.23 | View in AlphaFoldDB ↗ |