DPCfam | MC292950
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 487 ± 34 aa |
| Residues in low-complexity regions (%) | 2.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12673- PF12673- PF12673- PF01476 |
| Sequences matching dominant architecture (%) | 53.21 |
| Average overlap percent | 94.78 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R6XT46 | 12-504 | 493 | INQIIGQKRAETLVEGDVIVNDVKPDVLNIISANGIACVYKKEVMDGKIRIDGSVNTYIIYLADSENGNIRSLNTVLDFTQIIDI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O07532-F1 | 228-281 | 10.58 | 67.70 | View in AlphaFoldDB ↗ |