DPCfam | MC292776
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 429 ± 62 aa |
| Residues in low-complexity regions (%) | 3.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.36 |
| Average transmembrane regions | 0.21 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A165X9X0 | 472-972 | 500 | EMEVAQAITIPEPEPELAATTTSPIPSAIWDEDSPFVPPTAPYSDDDFEGDKFSERVYKLAVENNPNRLALVLEAPTIEELGARL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A4IAG7-F1 | 1020-1174 | 31.29 | 84.48 | View in AlphaFoldDB ↗ |