DPCfam | MC292747
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 761 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Residues in low-complexity regions (%) | 7.64 |
| Residues in coiled-coil regions (%) | 0.46 |
| Predicted disordered residues (%) | 2.55 |
| Average transmembrane regions | 2.73 |
| Dominant Pfam architecture(s) | PF06772 |
| Sequences matching dominant architecture (%) | 98.52 |
| Average overlap percent | 30.22 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K2LQB9 | 6-108 | 103 | LAPRHKDEPHRAATTLELMFDLASVIAIAAAAIGLHHGIAQGHALEAIPQFLFAFFAIWWSWMNYTWFASAYDNGSPGFLVLSMV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1D0C3-F1 | 30-117 | 92.63 | 90.78 | View in AlphaFoldDB ↗ |