DPCfam | MC292744
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 342 ± 53 aa |
| Residues in low-complexity regions (%) | 4.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.56 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF01365 |
| Sequences matching dominant architecture (%) | 1.44 |
| Average overlap percent | 10.24 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003F0DEC6 | 692-930 | 239 | HQLDLFGKLCEGRNDYAINVIAKELKYLTWEEAYNCLQNKNLPDQLRAKYCGLIISLFVDVGVNASILERVKLSYEWDEVQTGKS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q14573-F1 | 730-1099 | 100.00 | 69.92 | View in AlphaFoldDB ↗ |