DPCfam | MC29273
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 115 ± 13 aa |
| Residues in low-complexity regions (%) | 2.07 |
| Residues in coiled-coil regions (%) | 0.16 |
| Predicted disordered residues (%) | 2.49 |
| Average transmembrane regions | 2.75 |
| Dominant Pfam architecture(s) | PF13641 |
| Sequences matching dominant architecture (%) | 11.11 |
| Average overlap percent | 1.13 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G2QIH6 | 332-437 | 106 | DRSVWALQPYCVYAVYLTSLTNFAALTDGLLVYLLARSSAYSVGTLAGLVSWILLTKTVKVFDYFRRHPRDVVLFPAYLAFAYFH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q0E8-F1 | 316-455 | 96.49 | 79.94 | View in AlphaFoldDB ↗ |