DPCfam | MC29254
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 132 ± 16 aa |
| Residues in low-complexity regions (%) | 2.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.44 |
| Average transmembrane regions | 0.09 |
| Dominant Pfam architecture(s) | PF14668 |
| Sequences matching dominant architecture (%) | 90.07 |
| Average overlap percent | 53.2 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P5SAJ0 | 418-548 | 131 | GRYGRLSNVRHAIRDLPMPPHLFSQLNQHREGLDFLRTSGQLSKLFTVVTNASIETDEEILELKAAVWACAHLGTSEPGVALLES... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q2K3-F1 | 1052-1173 | 93.80 | 92.37 | View in AlphaFoldDB ↗ |