DPCfam | MC292330
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 125 ± 23 aa |
| Residues in low-complexity regions (%) | 3.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 62.61 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09316 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 60.3 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000522CA71 | 467-581 | 115 | PVKTLPFSPSQFFNTCSGNEQFNLDNPAFTSTPICGQKVLITTPLQKEMTPKDQKENVGFRTPTIRRSLLGSTPRTPTPFKNALA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7FFJ6-F1 | 460-579 | 96.80 | 51.51 | View in AlphaFoldDB ↗ |