DPCfam | MC29233
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 208 ± 31 aa |
| Residues in low-complexity regions (%) | 5.01 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.19 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02257 |
| Sequences matching dominant architecture (%) | 58.04 |
| Average overlap percent | 37.77 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006CEDAF0 | 58-251 | 194 | LVNRSLQQESKRNVELILEQISKLSPLEKLLLYLKLPTGKEYPDPLKQPSNPLGSRPEISQTIAWIKTHLKEDKHTSLPKQDVYN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0G2KLK6-F1 | 34-260 | 98.64 | 76.80 | View in AlphaFoldDB ↗ |