DPCfam | MC292110
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 87 ± 7 aa |
| Residues in low-complexity regions (%) | 0.77 |
| Residues in coiled-coil regions (%) | 0.39 |
| Predicted disordered residues (%) | 16.19 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF04998 |
| Sequences matching dominant architecture (%) | 76.16 |
| Average overlap percent | 19.96 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7QLG5 | 962-1077 | 116 | NIRPDSVSDLNPDQILKGVKMLMKRTRVIVLGDEDEEEANATRNDDEGNVEDRKPTLVDPIAREVQENATLLFQIHLRSMLACKK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D4A5A6-F1 | 994-1084 | 100.00 | 95.17 | View in AlphaFoldDB ↗ |