DPCfam | MC292015
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 893 ± 145 aa |
| Residues in low-complexity regions (%) | 28.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.09 |
| Average transmembrane regions | 7.96 |
| Dominant Pfam architecture(s) | PF02687 |
| Sequences matching dominant architecture (%) | 39.0 |
| Average overlap percent | 9.01 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0V8SB04 | 29-625 | 597 | AGAAVALRVVPWVARRAEVRADRSAGLVLPLASWEVARRGHSTGAALLLVLATAAATFGTSLGATWATSAQDQADTAVGADLAVG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F5L3-F1 | 136-516 | 45.30 | 86.04 | View in AlphaFoldDB ↗ |