DPCfam | MC291923
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 561 |
|---|---|
| Mean domain length (aa) | 146 ± 15 aa |
| Residues in low-complexity regions (%) | 5.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02542 |
| Sequences matching dominant architecture (%) | 99.42 |
| Average overlap percent | 97.08 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D6PNQ1 | 56-206 | 151 | VGLGYDVHAFEEGRKLILCGIEIPHTKGLAGHSDADVGIHTLCDAIYGALAEGDIGRHFPPTDNEWKDMDSARFLVHAGERIRAR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q47956-F1 | 4-154 | 100.00 | 96.82 | View in AlphaFoldDB ↗ |