DPCfam | MC291766
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 132 ± 36 aa |
| Residues in low-complexity regions (%) | 5.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.08 |
| Average transmembrane regions | 0.57 |
| Dominant Pfam architecture(s) | PF07509 |
| Sequences matching dominant architecture (%) | 61.11 |
| Average overlap percent | 83.45 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G3CK82 | 11-163 | 153 | YLVCFAIGTGLLCSFYLPSTDIVKITGSEVKRVDNDGPISAKNPADGPTRDVYYIYTIDQNKKIMVYRNEDTGWSFPWYFKFNSA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P43999-F1 | 8-136 | 98.28 | 95.29 | View in AlphaFoldDB ↗ |