DPCfam | MC291687
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 211 ± 25 aa |
| Residues in low-complexity regions (%) | 4.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.8 |
| Average transmembrane regions | 0.4 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M6MG69 | 24-230 | 207 | VILLSFGILGYYGFEIYQESPPIPEKVISADNEVVFTGNDIKEGQNIWQSIGGQEVGSIWGHGAYVAPDWTADWLHREAIFILNG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F7A5-F1 | 11-233 | 99.09 | 97.54 | View in AlphaFoldDB ↗ |