DPCfam | MC291646
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 259 ± 30 aa |
| Residues in low-complexity regions (%) | 7.02 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 55.94 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08621 |
| Sequences matching dominant architecture (%) | 96.55 |
| Average overlap percent | 16.1 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K7IMJ9 | 6-238 | 233 | IPIKRPKPGDGEEELLRMQEEFNAKKLTPCAKVINLCSQNKQEEAPVKKQSKFAKDRSVAQQKRISTSQACGNVTKVDPEELDKA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q80TE0-F1 | 2-280 | 99.59 | 46.90 | View in AlphaFoldDB ↗ |