DPCfam | MC291241
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 119 ± 12 aa |
| Residues in low-complexity regions (%) | 1.11 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.6 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06798 |
| Sequences matching dominant architecture (%) | 98.15 |
| Average overlap percent | 48.65 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I3X7Y5 | 505-650 | 145 | QNLFDRYIAYADAWLEDQDFKDPDTGQILNRKILDSELSQIEKPAGIANPKDFRNEVVKFTLRARAKNHGRNPSWTSYEKLREVI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P39134-F1 | 513-631 | 99.16 | 87.46 | View in AlphaFoldDB ↗ |