DPCfam | MC290674
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 132 ± 27 aa |
| Residues in low-complexity regions (%) | 3.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.19 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF02820- PF12140 |
| Sequences matching dominant architecture (%) | 88.68 |
| Average overlap percent | 58.35 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3ISJ9 | 212-353 | 142 | SRDIFAVGWCSLSGHPLQPPGQKGLAQYQLNKLMKNPSLLLTIPPSVNVANHGGGRPSSQSQVSETEPSPGGAGSQLSAEYTLAE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5VUG0-F1 | 456-575 | 100.00 | 68.23 | View in AlphaFoldDB ↗ |