DPCfam | MC29023
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 112 ± 18 aa |
| Residues in low-complexity regions (%) | 5.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.87 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16207 |
| Sequences matching dominant architecture (%) | 92.86 |
| Average overlap percent | 75.01 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q9VB08 | 325-435 | 111 | DEIELVFKPHPTEMSADNQLIRALKENCVRYIKTTANATVDHLSKYLAMRLTLDLGADLPEACRVLNFCIYVAPQPQQLVILNGN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q99496-F1 | 224-333 | 99.08 | 84.91 | View in AlphaFoldDB ↗ |