DPCfam | MC289761
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 116 ± 17 aa |
| Residues in low-complexity regions (%) | 3.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00169 |
| Sequences matching dominant architecture (%) | 66.67 |
| Average overlap percent | 21.49 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T1ISD9 | 1488-1598 | 111 | SLKTCWDILKADNRNFLTLVTSVFPSAKDQEWLISELRDERFFDVFEYNGPLTQWGCFLCNHPDRAVGFLQDREPVIEGQLKEKK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A158Q2Z1-F1 | 700-837 | 99.21 | 77.52 | View in AlphaFoldDB ↗ |