DPCfam | MC289610
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 112 ± 16 aa |
| Residues in low-complexity regions (%) | 3.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 44.49 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02195 |
| Sequences matching dominant architecture (%) | 46.03 |
| Average overlap percent | 2.63 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M9ML68 | 87-174 | 88 | IDENLFRRDLSVMDRSAFLAERKAIYEELYPETKAGGDRRSDQNDKLVGLVPTFTAETAEKLGCSGRSIERAIARFKGIDPDKDP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4DN34-F1 | 747-770 | 20.69 | 87.04 | View in AlphaFoldDB ↗ |