DPCfam | MC289565
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 437 ± 60 aa |
| Residues in low-complexity regions (%) | 4.1 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.56 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF02759- PF01477- PF02759 |
| Sequences matching dominant architecture (%) | 65.35 |
| Average overlap percent | 80.33 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A158PNJ6 | 1278-1774 | 496 | SSDSTPETGGGSPRKRSGSRAHSPDPKQGLPALPMHIAYDLRNVLRMTDIKTDIGYARAFVRLALERKLLHKHLKTILSNTALLQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7DNE8-F1 | 997-1461 | 98.66 | 76.06 | View in AlphaFoldDB ↗ |