DPCfam | MC289533
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1341 |
|---|---|
| Mean domain length (aa) | 126 ± 28 aa |
| Residues in low-complexity regions (%) | 0.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.51 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00337 |
| Sequences matching dominant architecture (%) | 84.29 |
| Average overlap percent | 88.02 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G8ENP0 | 11-122 | 112 | LKVGHTLTITGIPKTGVRRFLMNIDYGADIAFHMSVWLNTTSVRYKDLVVYNTYQGGRWRQEIKHGLFPFAQKELFKFTVTLTRE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4II06-F1 | 26-149 | 97.62 | 84.75 | View in AlphaFoldDB ↗ |