DPCfam | MC28953
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Residues in low-complexity regions (%) | 3.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 60.07 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08688 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 32.28 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W5MXB8 | 169-276 | 108 | PQAVRIGGRKRLTPEQKKLCYSEPEKLNQLGGSAHHSEQQSLGNEGEGLLSKDDLGEYGLVAARRKMFEMRGRTMSASSISKSTL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q01613-F1 | 589-693 | 93.86 | 53.72 | View in AlphaFoldDB ↗ |