DPCfam | MC289492
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 368 ± 44 aa |
| Residues in low-complexity regions (%) | 5.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.35 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF06545 |
| Sequences matching dominant architecture (%) | 97.87 |
| Average overlap percent | 57.37 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0002EBF077 | 21-394 | 374 | LSEANNEAVTHVLSARPCWNGVSLVKDVIIGKERCLYHAGPAYSCINAIPSSVRNSLAFGCIFEGWAQDWSEANHLLEAGEIRIL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P77221-F1 | 71-452 | 99.74 | 97.26 | View in AlphaFoldDB ↗ |